SH3BP2 antibody (Middle Region)

Catalog No. ABIN634378

This Rabbit Polyclonal antibody specifically detects SH3BP2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SH3BP2 antibody (Middle Region) (ABIN634378)

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SH3BP2 Antibody

Binding Specificity: Middle Region

Specificity: SH3 BP2 antibody was raised against the middle region of SH3 P2

Purification: Affinity purified

Immunogen: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BP2 Blocking Peptide, (ABIN5616123), is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BP2

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Alternative Name: SH3BP2

Background: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: TCR Signaling