NKIRAS2 antibody (Middle Region)

Catalog No. ABIN634432

This Rabbit Polyclonal antibody specifically detects NKIRAS2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NKIRAS2 antibody (Middle Region) (ABIN634432)

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKIRAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NKIRAS2 Antibody

Binding Specificity: Middle Region

Specificity: NKIRAS2 antibody was raised against the middle region of NKIRAS2

Purification: Affinity purified

Immunogen: NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKIRAS2 Blocking Peptide, (ABIN939846), is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKIRAS2

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Alternative Name: NKIRAS2

Background: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Molecular Weight: 21 kDa (MW of target protein)