RAB11B antibody (C-Term)

Catalog No. ABIN634441

This Rabbit Polyclonal antibody specifically detects RAB11B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RAB11B antibody (C-Term) (ABIN634441)

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB11B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB11B Antibody

Binding Specificity: C-Term

Specificity: RAB11 B antibody was raised against the C terminal of RAB11

Purification: Affinity purified

Immunogen: RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB11B Blocking Peptide, (ABIN939339), is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB11B

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Alternative Name: RAB11B

Background: RAB11B possesses GTPase activity.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis