LTA4H antibody (Middle Region)

Catalog No. ABIN634453

This Rabbit Polyclonal antibody specifically detects LTA4H in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LTA4H antibody (Middle Region) (ABIN634453)

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LTA4H antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LTA4H Antibody

Binding Specificity: Middle Region

Specificity: LTA4 H antibody was raised against the middle region of LTA4

Purification: Affinity purified

Immunogen: LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LTA4H Blocking Peptide, (ABIN5614603), is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LTA4H

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Alternative Name: LTA4H

Background: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Molecular Weight: 69 kDa (MW of target protein)