RCAN3 antibody (Middle Region)

Catalog No. ABIN634456

This Rabbit Polyclonal antibody specifically detects RCAN3 in WB. It exhibits reactivity toward Human.

Quick Overview for RCAN3 antibody (Middle Region) (ABIN634456)

Target: RCAN3 (RCAN Family Member 3 (RCAN3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RCAN3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RCAN3 Antibody

Binding Specificity: Middle Region

Specificity: RCAN3 antibody was raised against the middle region of RCAN3

Purification: Affinity purified

Immunogen: RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RCAN3 Blocking Peptide, (ABIN5615813), is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCAN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RCAN3

Target: RCAN3 (RCAN Family Member 3 (RCAN3))

Alternative Name: RCAN3

Background: RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.

Molecular Weight: 27 kDa (MW of target protein)