SDCBP2 antibody

Catalog No. ABIN634476

The Rabbit Polyclonal anti-SDCBP2 antibody (ABIN634476) specifically detects SDCBP2 in WB. The antibody is reactive with Human samples.

Quick Overview for SDCBP2 antibody (ABIN634476)

Target: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDCBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SDCBP2 Antibody

Purification: Affinity purified

Immunogen: SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDCBP2 Blocking Peptide, (ABIN5616023), is also available for use as a blocking control in assays to test for specificity of this SDCBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDCBP2

Target: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Alternative Name: SDCBP2

Background: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Molecular Weight: 23 kDa (MW of target protein)