CHST15 antibody (Middle Region)

Catalog No. ABIN634517

The Rabbit Polyclonal anti-CHST15 antibody is suitable to detect CHST15 in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for CHST15 antibody (Middle Region) (ABIN634517)

Target: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHST15 Antibody

Binding Specificity: Middle Region

Specificity: GALNAC4 S-4 T antibody was raised against the middle region of GALNAC4 -4 T

Purification: Affinity purified

Immunogen: GALNAC4 S-4 T antibody was raised using the middle region of GALNAC4 -4 T corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNAC4S-6ST Blocking Peptide, (ABIN936033), is also available for use as a blocking control in assays to test for specificity of this GALNAC4S-6ST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNAC0 -0 T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST15

Target: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Alternative Name: GALNAC4S-6ST

Background: GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression, however such results are unclear in vivo.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process