CCRL2 antibody

Catalog No. ABIN634522

This Rabbit Polyclonal antibody specifically detects CCRL2 in WB. It exhibits reactivity toward Human.

Quick Overview for CCRL2 antibody (ABIN634522)

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCRL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCRL2 Antibody

Purification: Affinity purified

Immunogen: CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCRL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCRL2

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Alternative Name: CCRL2

Background: CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.

Molecular Weight: 39 kDa (MW of target protein)