HLA-DPA1 antibody (Middle Region)

Catalog No. ABIN634553

The Rabbit Polyclonal anti-HLA-DPA1 antibody is suitable to detect HLA-DPA1 in samples from Human. It has been validated for WB.

Quick Overview for HLA-DPA1 antibody (Middle Region) (ABIN634553)

Target: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLA-DPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HLA-DPA1 Antibody

Binding Specificity: Middle Region

Specificity: HLA-DPA1 antibody was raised against the middle region of HLA-DPA1

Purification: Affinity purified

Immunogen: HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HLA-DPA1 Blocking Peptide, (ABIN937661), is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HLA-DPA1

Target: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Alternative Name: HLA-DPA1

Background: HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: TCR Signaling, Cancer Immune Checkpoints, Human Leukocyte Antigen (HLA) in Adaptive Immune Response