Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Shisa Homolog 5 (Xenopus Laevis) (SHISA5) antibody

Antigen

Shisa Homolog 5 (Xenopus Laevis) (SHISA5)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634555
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SCOTIN
Immunogen SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV
Description This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.
Molecular Weight 25 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCOTIN antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Shisa Homolog 5 (Xenopus Laevis) (SHISA5)", type "Antibodies"
Hosts Mouse (3)
Reactivities Human (3)
Applications Western Blotting (WB) (3), ELISA (Detection) (2), Enzyme Immunoassay (EIA) (1)