PEA15 antibody (Middle Region)

Catalog No. ABIN634601

The Rabbit Polyclonal anti-PEA15 antibody is suitable to detect PEA15 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PEA15 antibody (Middle Region) (ABIN634601)

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEA15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEA15 Antibody

Binding Specificity: Middle Region

Specificity: PEA15 antibody was raised against the middle region of PEA15

Purification: Affinity purified

Immunogen: PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEA15 Blocking Peptide, (ABIN937444), is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEA15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEA15

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Alternative Name: PEA15

Background: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Molecular Weight: 15 kDa (MW of target protein)