IGFALS antibody (Middle Region)

Catalog No. ABIN634631

The Rabbit Polyclonal anti-IGFALS antibody is suitable to detect IGFALS in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for IGFALS antibody (Middle Region) (ABIN634631)

Target: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGFALS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IGFALS Antibody

Binding Specificity: Middle Region

Specificity: IGFALS antibody was raised against the middle region of IGFALS

Purification: Affinity purified

Immunogen: IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGFALS Blocking Peptide, (ABIN5614156), is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFALS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGFALS

Target: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Alternative Name: IGFALS

Background: IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.

Molecular Weight: 63 kDa (MW of target protein)