Periostin antibody (Middle Region)

Catalog No. ABIN634643

The Rabbit Polyclonal anti-Periostin antibody is suitable to detect Periostin in samples from Human and Mouse. It has been validated for WB.

Quick Overview for Periostin antibody (Middle Region) (ABIN634643)

Target: Periostin (POSTN)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Periostin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Periostin Antibody

Binding Specificity: Middle Region

Specificity: POSTN antibody was raised against the middle region of POSTN

Purification: Affinity purified

Immunogen: POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POSTN Blocking Peptide, (ABIN5615476), is also available for use as a blocking control in assays to test for specificity of this POSTN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Periostin

Target: Periostin (POSTN)

Alternative Name: POSTN

Background: POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Molecular Weight: 93 kDa (MW of target protein)