Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) antibody

Antigen

Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP)

Synonyms 90K, BTBD17B, MAC-2-BP, Ppicap, MGC93166
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634658
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LGALS3BP
Immunogen LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
Description The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
Molecular Weight 63 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS3BP antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Cell Cycle

Alternatives

Alternatives for antigen "Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP)", type "Antibodies"
Hosts Rabbit (20), Mouse (8)
Reactivities Human (28), Mouse (Murine) (20), Rat (Rattus) (5), Horse (Equine) (2), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Pig (Porcine) (1), Rabbit (1)
Applications Flow Cytometry (FACS) (25), Immunofluorescence (IF) (20), Western Blotting (WB) (11), Immunohistochemistry (IHC) (4), ELISA (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates FITC (2), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)