SSPN antibody

Catalog No. ABIN634685

The Rabbit Polyclonal anti-SSPN antibody is suitable to detect SSPN in samples from Human. It has been validated for WB.

Quick Overview for SSPN antibody (ABIN634685)

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSPN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SSPN Antibody

Purification: Affinity purified

Immunogen: Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sarcospan Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSPN

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Alternative Name: Sarcospan

Background: SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.

Molecular Weight: 26 kDa (MW of target protein)