Ephrin B1 antibody (Middle Region)

Catalog No. ABIN634690

This Rabbit Polyclonal antibody specifically detects Ephrin B1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for Ephrin B1 antibody (Middle Region) (ABIN634690)

Target: Ephrin B1 (EFNB1)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ephrin B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Ephrin B1 Antibody

Binding Specificity: Middle Region

Specificity: Ephrin-B1 antibody was raised against the middle region of EFNB1

Purification: Affinity purified

Immunogen: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ephrin-B1 Blocking Peptide, (ABIN5613384), is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ephrin B1

Target: Ephrin B1 (EFNB1)

Alternative Name: Ephrin-B1

Background: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: RTK Signaling