Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Platelet-Derived Growth Factor, D Polypeptide (PDGFD) antibody

Antigen

Platelet-Derived Growth Factor, D Polypeptide (PDGFD)

Synonyms 1110003I09Rik, PDGFD
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634793
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name PDGFD
Immunogen PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
Description The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.
Molecular Weight 40 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDGFD antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Platelet-Derived Growth Factor, D Polypeptide (PDGFD)", type "Antibodies"
Hosts Mouse (4), Rabbit (3)
Reactivities Human (7)
Applications Western Blotting (WB) (4), ELISA (Detection) (3), Enzyme Immunoassay (EIA) (3), Flow Cytometry (FACS) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)