SLC6A15 antibody (N-Term)

Catalog No. ABIN634835

The Rabbit Polyclonal anti-SLC6A15 antibody is suitable to detect SLC6A15 in samples from Human. It has been validated for WB.

Quick Overview for SLC6A15 antibody (N-Term) (ABIN634835)

Target: SLC6A15 (Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC6A15 Antibody

Binding Specificity: N-Term

Specificity: SLC6 A15 antibody was raised against the N terminal of SLC6 15

Purification: Affinity purified

Immunogen: SLC6 A15 antibody was raised using the N terminal of SLC6 15 corresponding to a region with amino acids DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A15 Blocking Peptide, (ABIN937509), is also available for use as a blocking control in assays to test for specificity of this SLC6A15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A15

Target: SLC6A15 (Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15))

Alternative Name: SLC6A15

Background: SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.

Molecular Weight: 82 kDa (MW of target protein)