KCC2 antibody

Catalog No. ABIN634866

The Rabbit Polyclonal anti-KCC2 antibody (ABIN634866) specifically detects KCC2 in WB. The antibody is reactive with Human samples.

Quick Overview for KCC2 antibody (ABIN634866)

Target: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCC2 Antibody

Purification: Affinity purified

Immunogen: SLC12 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A5 Blocking Peptide, (ABIN5616177), is also available for use as a blocking control in assays to test for specificity of this SLC12A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCC2

Target: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Alternative Name: SLC12A5

Background: K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential.

Molecular Weight: 123 kDa (MW of target protein)