DPP6 antibody (Middle Region)

Catalog No. ABIN634901

The Rabbit Polyclonal anti-DPP6 antibody is suitable to detect DPP6 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for DPP6 antibody (Middle Region) (ABIN634901)

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPP6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPP6 Antibody

Binding Specificity: Middle Region

Specificity: DPP6 antibody was raised against the middle region of DPP6

Purification: Affinity purified

Immunogen: DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPP6 Blocking Peptide, (ABIN938350), is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPP6

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Alternative Name: DPP6

Background: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

Molecular Weight: 91 kDa (MW of target protein)