TSPAN4 antibody (Middle Region)

Catalog No. ABIN634910

The Rabbit Polyclonal anti-TSPAN4 antibody is suitable to detect TSPAN4 in samples from Human. It has been validated for WB.

Quick Overview for TSPAN4 antibody (Middle Region) (ABIN634910)

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSPAN4 Antibody

Binding Specificity: Middle Region

Specificity: Tetraspanin 4 antibody was raised against the middle region of TSPAN4

Purification: Affinity purified

Immunogen: Tetraspanin 4 antibody was raised using the middle region of TSPAN4 corresponding to a region with amino acids YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 4 Blocking Peptide, (ABIN936235), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN4

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Alternative Name: Tetraspanin 4

Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 26 kDa (MW of target protein)