IGSF11 antibody (Middle Region)

Catalog No. ABIN634976

The Rabbit Polyclonal anti-IGSF11 antibody is suitable to detect IGSF11 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for IGSF11 antibody (Middle Region) (ABIN634976)

Target: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGSF11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IGSF11 Antibody

Binding Specificity: Middle Region

Specificity: IGSF11 antibody was raised against the middle region of IGSF11

Purification: Affinity purified

Immunogen: IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGSF11 Blocking Peptide, (ABIN937896), is also available for use as a blocking control in assays to test for specificity of this IGSF11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGSF11

Target: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Alternative Name: IGSF11

Background: IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule.

Molecular Weight: 46 kDa (MW of target protein)