ALDH6A1 antibody (Middle Region)

Catalog No. ABIN635061

The Rabbit Polyclonal anti-ALDH6A1 antibody (ABIN635061) specifically detects ALDH6A1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for ALDH6A1 antibody (Middle Region) (ABIN635061)

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALDH6A1 Antibody

Binding Specificity: Middle Region

Specificity: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Purification: Affinity purified

Immunogen: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH6A1 Blocking Peptide, (ABIN938904), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH6A1

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Alternative Name: ALDH6A1

Background: ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation