ALDH6A1 antibody (Middle Region)

Catalog No. ABIN635062

This Rabbit Polyclonal antibody specifically detects ALDH6A1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ALDH6A1 antibody (Middle Region) (ABIN635062)

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALDH6A1 Antibody

Binding Specificity: Middle Region

Specificity: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Purification: Affinity purified

Immunogen: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH6A1 Blocking Peptide, (ABIN936992), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH6A1

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Alternative Name: ALDH6A1

Background: This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation