SLC25A20 antibody

Catalog No. ABIN635078

The Rabbit Polyclonal anti-SLC25A20 antibody is suitable to detect SLC25A20 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for SLC25A20 antibody (ABIN635078)

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A20 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A20 Antibody

Purification: Affinity purified

Immunogen: SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A20 Blocking Peptide, (ABIN5616212), is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A20

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Alternative Name: SLC25A20

Background: SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades