SLC15A4 antibody (Middle Region)

Catalog No. ABIN635120

The Rabbit Polyclonal anti-SLC15A4 antibody is suitable to detect SLC15A4 in samples from Human. It has been validated for WB.

Quick Overview for SLC15A4 antibody (Middle Region) (ABIN635120)

Target: SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC15A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC15A4 Antibody

Binding Specificity: Middle Region

Specificity: SLC15 A4 antibody was raised against the middle region of SLC15 4

Purification: Affinity purified

Immunogen: SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC15A4 Blocking Peptide, (ABIN938795), is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC15A4

Target: SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))

Alternative Name: SLC15A4

Background: SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.

Molecular Weight: 62 kDa (MW of target protein)