FAM19A4 antibody (Middle Region)

Catalog No. ABIN635134

This Rabbit Polyclonal antibody specifically detects FAM19A4 in WB. It exhibits reactivity toward Human.

Quick Overview for FAM19A4 antibody (Middle Region) (ABIN635134)

Target: FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM19A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM19A4 Antibody

Binding Specificity: Middle Region

Specificity: FAM19 A4 antibody was raised against the middle region of FAM19 4

Purification: Affinity purified

Immunogen: FAM19 A4 antibody was raised using the middle region of FAM19 4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM19A4 Blocking Peptide, (ABIN5613478), is also available for use as a blocking control in assays to test for specificity of this FAM19A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM19A4

Target: FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))

Alternative Name: FAM19A4

Background: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.

Molecular Weight: 16 kDa (MW of target protein)