SLCO1A2 antibody (Middle Region)

Catalog No. ABIN635140

This Rabbit Polyclonal antibody specifically detects SLCO1A2 in WB. It exhibits reactivity toward Human.

Quick Overview for SLCO1A2 antibody (Middle Region) (ABIN635140)

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLCO1A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLCO1A2 Antibody

Binding Specificity: Middle Region

Specificity: SLCO1 A2 antibody was raised against the middle region of SLCO1 2

Purification: Affinity purified

Immunogen: SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO1A2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLCO1A2

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Alternative Name: SLCO1A2

Background: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.

Molecular Weight: 64 kDa (MW of target protein)