Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) antibody

Catalog No. ABIN635159

The Rabbit Polyclonal anti-Solute Carrier Organic Anion Transporter Family, Member 3A1 antibody is suitable to detect Solute Carrier Organic Anion Transporter Family, Member 3A1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) antibody (ABIN635159)

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: SLCO3 A1 antibody was raised against the middle region of SLCO3 1

Purification: Affinity purified

Immunogen: SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO3A1 Blocking Peptide, (ABIN5616286), is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Alternative Name: SLCO3A1

Background: SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.

Molecular Weight: 76 kDa (MW of target protein)