LAX1 antibody (Middle Region)

Catalog No. ABIN635163

The Rabbit Polyclonal anti-LAX1 antibody (ABIN635163) specifically detects LAX1 in WB. The antibody is reactive with Human samples.

Quick Overview for LAX1 antibody (Middle Region) (ABIN635163)

Target: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LAX1 Antibody

Binding Specificity: Middle Region

Specificity: LAX1 antibody was raised against the middle region of LAX1

Purification: Affinity purified

Immunogen: LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAX1 Blocking Peptide, (ABIN940341), is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAX1

Target: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Alternative Name: LAX1

Background: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response