SFXN3 antibody (Middle Region)

Catalog No. ABIN635208

The Rabbit Polyclonal anti-SFXN3 antibody (ABIN635208) specifically detects SFXN3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SFXN3 antibody (Middle Region) (ABIN635208)

Target: SFXN3 (Sideroflexin 3 (SFXN3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFXN3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SFXN3 Antibody

Binding Specificity: Middle Region

Specificity: Sideroflexin 3 antibody was raised against the middle region of SFXN3

Purification: Affinity purified

Immunogen: Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sideroflexin 3 Blocking Peptide, (ABIN5616140), is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFXN3

Target: SFXN3 (Sideroflexin 3 (SFXN3))

Alternative Name: Sideroflexin 3

Background: SFXN3 is a potential iron transporter.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis