EBP antibody

Catalog No. ABIN635262

The Rabbit Polyclonal anti-EBP antibody (ABIN635262) specifically detects EBP in WB. The antibody is reactive with Human samples.

Quick Overview for EBP antibody (ABIN635262)

Target: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EBP Antibody

Purification: Affinity purified

Immunogen: EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EBP Blocking Peptide, (ABIN5613293), is also available for use as a blocking control in assays to test for specificity of this EBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EBP

Target: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Alternative Name: EBP

Background: EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.

Molecular Weight: 26 kDa (MW of target protein)