Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 17 (Anion/Sugar Transporter), Member 5 (SLC17A5) antibody

Antigen

Solute Carrier Family 17 (Anion/Sugar Transporter), Member 5 (SLC17A5)

Synonyms SLC17A5, sb:cb809, MGC153077, zgc:153077
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN635267
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SLC17A5
Immunogen SLC17A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Description SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
Molecular Weight 55 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC17A5 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism

Alternatives

Alternatives for antigen "Solute Carrier Family 17 (Anion/Sugar Transporter), Member 5 (SLC17A5)", type "Antibodies"
Hosts Rabbit (1)
Reactivities Human (1)
Applications ELISA (1), Immunohistochemistry (IHC) (1), Western Blotting (WB) (1)