PLGRKT antibody (Middle Region)

Catalog No. ABIN635312

The Rabbit Polyclonal anti-PLGRKT antibody is suitable to detect PLGRKT in samples from Human. It has been validated for WB.

Quick Overview for PLGRKT antibody (Middle Region) (ABIN635312)

Target: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLGRKT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLGRKT Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF46 antibody was raised against the middle region of C9 rf46

Purification: Affinity purified

Immunogen: C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF46 Blocking Peptide, (ABIN938997), is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLGRKT

Target: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Alternative Name: C9ORF46

Background: The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 17 kDa (MW of target protein)