Slc30a3 antibody

Catalog No. ABIN635335

This Rabbit Polyclonal antibody specifically detects Slc30a3 in WB. It exhibits reactivity toward Human.

Quick Overview for Slc30a3 antibody (ABIN635335)

Target: Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Slc30a3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Slc30a3 Antibody

Purification: Affinity purified

Immunogen: SLC30 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC30A3 Blocking Peptide, (ABIN936774), is also available for use as a blocking control in assays to test for specificity of this SLC30A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Slc30a3

Target: Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))

Alternative Name: SLC30A3

Background: SLC30A3 is involved in accumulation of zinc in synaptic vesicles.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis