OR2AT4 antibody (N-Term)

Catalog No. ABIN635349

The Rabbit Polyclonal anti-OR2AT4 antibody (ABIN635349) specifically detects OR2AT4 in WB. The antibody is reactive with Human samples.

Quick Overview for OR2AT4 antibody (N-Term) (ABIN635349)

Target: OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR2AT4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OR2AT4 Antibody

Binding Specificity: N-Term

Specificity: OR2 AT4 antibody was raised against the N terminal of OR2 T4

Purification: Affinity purified

Immunogen: OR2 AT4 antibody was raised using the N terminal of OR2 T4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR2AT4 Blocking Peptide, (ABIN5615134), is also available for use as a blocking control in assays to test for specificity of this OR2AT4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 T4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR2AT4

Target: OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))

Alternative Name: OR2AT4

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Molecular Weight: 35 kDa (MW of target protein)