SLC16A1 antibody

Catalog No. ABIN635368

This Rabbit Polyclonal antibody specifically detects SLC16A1 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC16A1 antibody (ABIN635368)

Target: SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC16A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC16A1 Antibody

Purification: Affinity purified

Immunogen: SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC16A1 Blocking Peptide, (ABIN937882), is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC16A1

Target: SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))

Alternative Name: SLC16A1

Background: SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Warburg Effect