SLC12A8 antibody

Catalog No. ABIN635376

The Rabbit Polyclonal anti-SLC12A8 antibody (ABIN635376) specifically detects SLC12A8 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC12A8 antibody (ABIN635376)

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC12A8 Antibody

Purification: Affinity purified

Immunogen: SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A8 Blocking Peptide, (ABIN939392), is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC12A8

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Alternative Name: SLC12A8

Background: SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.

Molecular Weight: 78 kDa (MW of target protein)