SLC24A4 antibody

Catalog No. ABIN635379

The Rabbit Polyclonal anti-SLC24A4 antibody (ABIN635379) specifically detects SLC24A4 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC24A4 antibody (ABIN635379)

Target: SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC24A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC24A4 Antibody

Purification: Affinity purified

Immunogen: SLC24 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC24A4 Blocking Peptide, (ABIN5616207), is also available for use as a blocking control in assays to test for specificity of this SLC24A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC24A4

Target: SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))

Alternative Name: SLC24A4

Background: Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions.

Molecular Weight: 65 kDa (MW of target protein)