TMEM38B antibody (C-Term)

Catalog No. ABIN635460

The Rabbit Polyclonal anti-TMEM38B antibody (ABIN635460) specifically detects TMEM38B in WB. The antibody is reactive with Human samples.

Quick Overview for TMEM38B antibody (C-Term) (ABIN635460)

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM38B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM38B Antibody

Binding Specificity: C-Term

Specificity: TMEM38 B antibody was raised against the C terminal of TMEM38

Purification: Affinity purified

Immunogen: TMEM38 B antibody was raised using the C terminal of TMEM38 corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM38B Blocking Peptide, (ABIN5616679), is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM38B

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Alternative Name: TMEM38B

Background: TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molecular Weight: 32 kDa (MW of target protein)