NAT8B antibody

Catalog No. ABIN635506

This Rabbit Polyclonal antibody specifically detects NAT8B in WB. It exhibits reactivity toward Human.

Quick Overview for NAT8B antibody (ABIN635506)

Target: NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAT8B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NAT8B Antibody

Purification: Affinity purified

Immunogen: NAT8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT8B Blocking Peptide, (ABIN5614920), is also available for use as a blocking control in assays to test for specificity of this NAT8B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAT8B

Target: NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))

Alternative Name: NAT8B

Background: The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.

Molecular Weight: 25 kDa (MW of target protein)