TPST2 antibody (Middle Region)

Catalog No. ABIN635521

This Rabbit Polyclonal antibody specifically detects TPST2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TPST2 antibody (Middle Region) (ABIN635521)

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPST2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPST2 Antibody

Binding Specificity: Middle Region

Specificity: TPST2 antibody was raised against the middle region of TPST2

Purification: Affinity purified

Immunogen: TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPST2 Blocking Peptide, (ABIN939631), is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPST2

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Alternative Name: TPST2

Background: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.

Molecular Weight: 42 kDa (MW of target protein)