ORCTL-2/SLC22A18 antibody (Middle Region)

Catalog No. ABIN635531

The Rabbit Polyclonal anti-ORCTL-2/SLC22A18 antibody is suitable to detect ORCTL-2/SLC22A18 in samples from Human. It has been validated for WB.

Quick Overview for ORCTL-2/SLC22A18 antibody (Middle Region) (ABIN635531)

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ORCTL-2/SLC22A18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ORCTL-2/SLC22A18 Antibody

Binding Specificity: Middle Region

Specificity: SLC22 A18 antibody was raised against the middle region of SLC22 18

Purification: Affinity purified

Immunogen: SLC22 A18 antibody was raised using the middle region of SLC22 18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A18 Blocking Peptide, (ABIN939496), is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ORCTL-2/SLC22A18

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Alternative Name: SLC22A18

Background: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Molecular Weight: 45 kDa (MW of target protein)