»
Antibodies
»
anti-Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2) antibody
Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2) antibody
| Antigen |
|
| Synonyms |
UBC4, PUBC1, UBC4/5, UBCH5B, E2(17)KB2, ubc4, Ubc2e, 1500034D03Rik, Ube2d2, eff, fb36f02, wu:fb36f02, UBE2D2, MGC138112, ube2d2, MGC55886, zgc:77149 |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN635549 |
| Quantity |
50 ug (1 mg/ml) (Variants) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
UBE2D2
|
|
Immunogen
|
UBE2D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSIC
|
|
Description
|
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
|
|
Molecular Weight
|
17 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE2D2 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2)", type "Antibodies"