MAS1 antibody (Middle Region)

Catalog No. ABIN635593

This Rabbit Polyclonal antibody specifically detects MAS1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAS1 antibody (Middle Region) (ABIN635593)

Target: MAS1 (MAS1 Oncogene (MAS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAS1 Antibody

Binding Specificity: Middle Region

Specificity: MAS1 antibody was raised against the middle region of MAS1

Purification: Affinity purified

Immunogen: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAS1 Blocking Peptide, (ABIN5614676), is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAS1

Target: MAS1 (MAS1 Oncogene (MAS1))

Alternative Name: MAS1

Background: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process