SIDT2 antibody (N-Term)

Catalog No. ABIN635622

The Rabbit Polyclonal anti-SIDT2 antibody (ABIN635622) specifically detects SIDT2 in WB. The antibody is reactive with Human samples.

Quick Overview for SIDT2 antibody (N-Term) (ABIN635622)

Target: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIDT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SIDT2 Antibody

Binding Specificity: N-Term

Specificity: SIDT2 antibody was raised against the N terminal of SIDT2

Purification: Affinity purified

Immunogen: SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIDT2 Blocking Peptide, (ABIN5616142), is also available for use as a blocking control in assays to test for specificity of this SIDT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIDT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIDT2

Target: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Alternative Name: SIDT2

Background: SIDT2 belongs to the SID1 family. It is a multi-pass membrane protein. The exact function of SIDT2 remains unknown.

Molecular Weight: 94 kDa (MW of target protein)