ZDHHC18 antibody (Middle Region)

Catalog No. ABIN635634

The Rabbit Polyclonal anti-ZDHHC18 antibody (ABIN635634) specifically detects ZDHHC18 in WB. The antibody is reactive with Human samples.

Quick Overview for ZDHHC18 antibody (Middle Region) (ABIN635634)

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZDHHC18 Antibody

Binding Specificity: Middle Region

Specificity: ZDHHC18 antibody was raised against the middle region of ZDHHC18

Purification: Affinity purified

Immunogen: ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC18 Blocking Peptide, (ABIN938452), is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC18

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Alternative Name: ZDHHC18

Background: ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

Molecular Weight: 42 kDa (MW of target protein)