Surfactant Protein C antibody (N-Term)

Catalog No. ABIN635635

This Rabbit Polyclonal antibody specifically detects Surfactant Protein C in WB. It exhibits reactivity toward Human.

Quick Overview for Surfactant Protein C antibody (N-Term) (ABIN635635)

Target: Surfactant Protein C (SFTPC)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Surfactant Protein C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Surfactant Protein C Antibody

Binding Specificity: N-Term

Specificity: SFTPC antibody was raised against the N terminal of SFTPC

Purification: Affinity purified

Immunogen: SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFTPC Blocking Peptide, (ABIN5616109), is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Surfactant Protein C

Target: Surfactant Protein C (SFTPC)

Alternative Name: SFTPC

Background: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.

Molecular Weight: 21 kDa (MW of target protein)