P4HTM antibody (Middle Region)

Catalog No. ABIN635662

This Rabbit Polyclonal antibody specifically detects P4HTM in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for P4HTM antibody (Middle Region) (ABIN635662)

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P4HTM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-P4HTM Antibody

Binding Specificity: Middle Region

Specificity: PH4 antibody was raised against the middle region of PH-4

Purification: Affinity purified

Immunogen: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PH4 Blocking Peptide, (ABIN938707), is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P4HTM

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Alternative Name: PH4

Background: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Molecular Weight: 57 kDa (MW of target protein)