SMPD1 antibody (Middle Region)

Catalog No. ABIN635693

The Rabbit Polyclonal anti-SMPD1 antibody is suitable to detect SMPD1 in samples from Human. It has been validated for WB.

Quick Overview for SMPD1 antibody (Middle Region) (ABIN635693)

Target: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMPD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SMPD1 Antibody

Binding Specificity: Middle Region

Specificity: SMPD1 antibody was raised against the middle region of SMPD1

Purification: Affinity purified

Immunogen: SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMPD1 Blocking Peptide, (ABIN939468), is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMPD1

Target: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Alternative Name: SMPD1

Background: SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

Molecular Weight: 65 kDa (MW of target protein)